Anti FLYWCH1 pAb (ATL-HPA041001)
Atlas Antibodies
- SKU:
- ATL-HPA041001-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FLYWCH1
Alternative Gene Name: DKFZp761A132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040097: 65%, ENSRNOG00000004333: 65%
Entrez Gene ID: 84256
Uniprot ID: Q4VC44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLASTLQILPVEEQGGVVQPALEMPEQKCSKLDAAAPQSLEFLRTPFGGRLLVLESFLYKQEKAVGDKVYWKCRQHAELGCRGRAITRGLRATVMRGHC |
Gene Sequence | TLASTLQILPVEEQGGVVQPALEMPEQKCSKLDAAAPQSLEFLRTPFGGRLLVLESFLYKQEKAVGDKVYWKCRQHAELGCRGRAITRGLRATVMRGHC |
Gene ID - Mouse | ENSMUSG00000040097 |
Gene ID - Rat | ENSRNOG00000004333 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FLYWCH1 pAb (ATL-HPA041001) | |
Datasheet | Anti FLYWCH1 pAb (ATL-HPA041001) Datasheet (External Link) |
Vendor Page | Anti FLYWCH1 pAb (ATL-HPA041001) at Atlas Antibodies |
Documents & Links for Anti FLYWCH1 pAb (ATL-HPA041001) | |
Datasheet | Anti FLYWCH1 pAb (ATL-HPA041001) Datasheet (External Link) |
Vendor Page | Anti FLYWCH1 pAb (ATL-HPA041001) |