Anti FLYWCH1 pAb (ATL-HPA040753)

Atlas Antibodies

SKU:
ATL-HPA040753-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FLYWCH-type zinc finger 1
Gene Name: FLYWCH1
Alternative Gene Name: DKFZp761A132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040097: 69%, ENSRNOG00000004333: 67%
Entrez Gene ID: 84256
Uniprot ID: Q4VC44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEFLRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQPDLAGLEALRQRERLPTTAQQEDPEKIQVQLCFKTCSPESQQIYG
Gene Sequence LEFLRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQPDLAGLEALRQRERLPTTAQQEDPEKIQVQLCFKTCSPESQQIYG
Gene ID - Mouse ENSMUSG00000040097
Gene ID - Rat ENSRNOG00000004333
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FLYWCH1 pAb (ATL-HPA040753)
Datasheet Anti FLYWCH1 pAb (ATL-HPA040753) Datasheet (External Link)
Vendor Page Anti FLYWCH1 pAb (ATL-HPA040753) at Atlas Antibodies

Documents & Links for Anti FLYWCH1 pAb (ATL-HPA040753)
Datasheet Anti FLYWCH1 pAb (ATL-HPA040753) Datasheet (External Link)
Vendor Page Anti FLYWCH1 pAb (ATL-HPA040753)



Citations for Anti FLYWCH1 pAb (ATL-HPA040753) – 1 Found
Muhammad, Belal A; Almozyan, Sheema; Babaei-Jadidi, Roya; Onyido, Emenike K; Saadeddin, Anas; Kashfi, Seyed Hossein; Spencer-Dene, Bradley; Ilyas, Mohammad; Lourdusamy, Anbarasu; Behrens, Axel; Nateri, Abdolrahman S. FLYWCH1, a Novel Suppressor of Nuclear β-Catenin, Regulates Migration and Morphology in Colorectal Cancer. Molecular Cancer Research : Mcr. 2018;16(12):1977-1990.  PubMed