Anti FLVCR1 pAb (ATL-HPA046646)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046646-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: FLVCR1
Alternative Gene Name: AXPC1, FLVCR, MFSD7B, PCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066595: 68%, ENSRNOG00000049633: 50%
Entrez Gene ID: 28982
Uniprot ID: Q9Y5Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | KSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI | 
| Gene Sequence | KSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI | 
| Gene ID - Mouse | ENSMUSG00000066595 | 
| Gene ID - Rat | ENSRNOG00000049633 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti FLVCR1 pAb (ATL-HPA046646) | |
| Datasheet | Anti FLVCR1 pAb (ATL-HPA046646) Datasheet (External Link) | 
| Vendor Page | Anti FLVCR1 pAb (ATL-HPA046646) at Atlas Antibodies | 
| Documents & Links for Anti FLVCR1 pAb (ATL-HPA046646) | |
| Datasheet | Anti FLVCR1 pAb (ATL-HPA046646) Datasheet (External Link) | 
| Vendor Page | Anti FLVCR1 pAb (ATL-HPA046646) | 
 
         
                             
                                        