Anti FLVCR1 pAb (ATL-HPA046646)

Atlas Antibodies

Catalog No.:
ATL-HPA046646-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: feline leukemia virus subgroup C cellular receptor 1
Gene Name: FLVCR1
Alternative Gene Name: AXPC1, FLVCR, MFSD7B, PCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066595: 68%, ENSRNOG00000049633: 50%
Entrez Gene ID: 28982
Uniprot ID: Q9Y5Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI
Gene Sequence KSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI
Gene ID - Mouse ENSMUSG00000066595
Gene ID - Rat ENSRNOG00000049633
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FLVCR1 pAb (ATL-HPA046646)
Datasheet Anti FLVCR1 pAb (ATL-HPA046646) Datasheet (External Link)
Vendor Page Anti FLVCR1 pAb (ATL-HPA046646) at Atlas Antibodies

Documents & Links for Anti FLVCR1 pAb (ATL-HPA046646)
Datasheet Anti FLVCR1 pAb (ATL-HPA046646) Datasheet (External Link)
Vendor Page Anti FLVCR1 pAb (ATL-HPA046646)