Anti FLVCR1 pAb (ATL-HPA046646)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046646-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FLVCR1
Alternative Gene Name: AXPC1, FLVCR, MFSD7B, PCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066595: 68%, ENSRNOG00000049633: 50%
Entrez Gene ID: 28982
Uniprot ID: Q9Y5Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI |
Gene Sequence | KSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI |
Gene ID - Mouse | ENSMUSG00000066595 |
Gene ID - Rat | ENSRNOG00000049633 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FLVCR1 pAb (ATL-HPA046646) | |
Datasheet | Anti FLVCR1 pAb (ATL-HPA046646) Datasheet (External Link) |
Vendor Page | Anti FLVCR1 pAb (ATL-HPA046646) at Atlas Antibodies |
Documents & Links for Anti FLVCR1 pAb (ATL-HPA046646) | |
Datasheet | Anti FLVCR1 pAb (ATL-HPA046646) Datasheet (External Link) |
Vendor Page | Anti FLVCR1 pAb (ATL-HPA046646) |