Anti FLT3 pAb (ATL-HPA047539)

Atlas Antibodies

Catalog No.: ATL-HPA047539-25

Protein Description: fms-related tyrosine kinase 3
Gene Name: FLT3
Alternative Gene Name: CD135, FLK2, STK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042817: 78%, ENSRNOG00000054764: 77%
Entrez Gene ID: 2322
Uniprot ID: P36888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS
• Gene Sequence: PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS
• Gene ID - Mouse: ENSMUSG00000042817
• Gene ID - Rat: ENSRNOG00000054764
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FLT3 pAb (ATL-HPA047539) – 1 Found

Lawal, Bashir; Kuo, Yu-Cheng; Khedkar, Harshita; Mokgautsi, Ntlotlang; Sumitra, Maryam Rachmawati; Wu, Alexander Th; Huang, Hsu-Shan. Deciphering the immuno-pathological role of FLT, and evaluation of a novel dual inhibitor of topoisomerases and mutant-FLT3 for treating leukemia. American Journal Of Cancer Research. 12(11):5140-5159.