Anti FLT3 pAb (ATL-HPA047539)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047539-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: FLT3
Alternative Gene Name: CD135, FLK2, STK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042817: 78%, ENSRNOG00000054764: 77%
Entrez Gene ID: 2322
Uniprot ID: P36888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS |
| Gene Sequence | PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS |
| Gene ID - Mouse | ENSMUSG00000042817 |
| Gene ID - Rat | ENSRNOG00000054764 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FLT3 pAb (ATL-HPA047539) | |
| Datasheet | Anti FLT3 pAb (ATL-HPA047539) Datasheet (External Link) |
| Vendor Page | Anti FLT3 pAb (ATL-HPA047539) at Atlas Antibodies |
| Documents & Links for Anti FLT3 pAb (ATL-HPA047539) | |
| Datasheet | Anti FLT3 pAb (ATL-HPA047539) Datasheet (External Link) |
| Vendor Page | Anti FLT3 pAb (ATL-HPA047539) |
| Citations for Anti FLT3 pAb (ATL-HPA047539) – 1 Found |
| Lawal, Bashir; Kuo, Yu-Cheng; Khedkar, Harshita; Mokgautsi, Ntlotlang; Sumitra, Maryam Rachmawati; Wu, Alexander Th; Huang, Hsu-Shan. Deciphering the immuno-pathological role of FLT, and evaluation of a novel dual inhibitor of topoisomerases and mutant-FLT3 for treating leukemia. American Journal Of Cancer Research. 12(11):5140-5159. PubMed |