Anti FLOT2 pAb (ATL-HPA001396 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001396-25

• 
• 

Protein Description: flotillin 2
Gene Name: FLOT2
Alternative Gene Name: ECS-1, ECS1, ESA, ESA1, M17S1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061981: 100%, ENSRNOG00000009681: 100%
Entrez Gene ID: 2319
Uniprot ID: Q14254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK
• Gene Sequence: ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK
• Gene ID - Mouse: ENSMUSG00000061981
• Gene ID - Rat: ENSRNOG00000009681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FLOT2 pAb (ATL-HPA001396 w/enhanced validation) – 1 Found

Petit, Marie; Walet-Balieu, Marie-Laure; Schapman, Damien; Golinski, Marie-Laure; Burel, Carole; Barray, Marion; Drouot, Laurent; Maho-Vaillant, Maud; Hébert, Vivien; Boyer, Olivier; Bardor, Muriel; Joly, Pascal; Calbo, Sébastien. Longitudinal Pathogenic Properties and N-Glycosylation Profile of Antibodies from Patients with Pemphigus after Corticosteroid Treatment. Biomedicines. 2021;9(10)