Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001393-25

Protein Description: flotillin 1
Gene Name: FLOT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059714: 99%, ENSRNOG00000000826: 99%
Entrez Gene ID: 10211
Uniprot ID: O75955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
• Gene Sequence: HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
• Gene ID - Mouse: ENSMUSG00000059714
• Gene ID - Rat: ENSRNOG00000000826
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation) – 2 Found

Bastrup, Joakim A; Aalkjær, Christian; Jepps, Thomas A. Identification of novel proteins and mechanistic pathways associated with early-onset hypertension by deep proteomic mapping of resistance arteries. The Journal Of Biological Chemistry. 2022;298(1):101512. 

Walton, Janelle R; Frey, Heather A; Vandre, Dale D; Kwiek, Jesse J; Ishikawa, Tomoko; Takizawa, Toshihiro; Robinson, John M; Ackerman, William E 4th. Expression of flotillins in the human placenta: potential implications for placental transcytosis. Histochemistry And Cell Biology. 2013;139(3):487-500.