Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001393-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: flotillin 1
Gene Name: FLOT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059714: 99%, ENSRNOG00000000826: 99%
Entrez Gene ID: 10211
Uniprot ID: O75955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
Gene Sequence HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
Gene ID - Mouse ENSMUSG00000059714
Gene ID - Rat ENSRNOG00000000826
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation)
Datasheet Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation)
Datasheet Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation)
Citations for Anti FLOT1 pAb (ATL-HPA001393 w/enhanced validation) – 2 Found
Bastrup, Joakim A; Aalkjær, Christian; Jepps, Thomas A. Identification of novel proteins and mechanistic pathways associated with early-onset hypertension by deep proteomic mapping of resistance arteries. The Journal Of Biological Chemistry. 2022;298(1):101512.  PubMed
Walton, Janelle R; Frey, Heather A; Vandre, Dale D; Kwiek, Jesse J; Ishikawa, Tomoko; Takizawa, Toshihiro; Robinson, John M; Ackerman, William E 4th. Expression of flotillins in the human placenta: potential implications for placental transcytosis. Histochemistry And Cell Biology. 2013;139(3):487-500.  PubMed