Anti FLNC pAb (ATL-HPA006135 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA006135-25

• 
• 

Protein Description: filamin C, gamma
Gene Name: FLNC
Alternative Gene Name: ABP-280, ABPL, FLN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068699: 99%, ENSRNOG00000007281: 99%
Entrez Gene ID: 2318
Uniprot ID: Q14315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
• Gene Sequence: HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
• Gene ID - Mouse: ENSMUSG00000068699
• Gene ID - Rat: ENSRNOG00000007281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FLNC pAb (ATL-HPA006135 w/enhanced validation) – 5 Found

Begay, Rene L; Tharp, Charles A; Martin, August; Graw, Sharon L; Sinagra, Gianfranco; Miani, Daniela; Sweet, Mary E; Slavov, Dobromir B; Stafford, Neil; Zeller, Molly J; Alnefaie, Rasha; Rowland, Teisha J; Brun, Francesca; Jones, Kenneth L; Gowan, Katherine; Mestroni, Luisa; Garrity, Deborah M; Taylor, Matthew R G. FLNC Gene Splice Mutations Cause Dilated Cardiomyopathy. Jacc. Basic To Translational Science. 2016;1(5):344-359. 

Krag, Thomas O; Holm-Yildiz, Sonja; Witting, Nanna; Vissing, John. Autophagy is affected in patients with hypokalemic periodic paralysis: an involvement in vacuolar myopathy?. Acta Neuropathologica Communications. 2021;9(1):109. 

Djuric, Ugljesa; Rodrigues, Deivid C; Batruch, Ihor; Ellis, James; Shannon, Patrick; Diamandis, Phedias. Spatiotemporal Proteomic Profiling of Human Cerebral Development. Molecular & Cellular Proteomics : Mcp. 2017;16(9):1548-1562. 

Papizan, James B; Garry, Glynnis A; Brezprozvannaya, Svetlana; McAnally, John R; Bassel-Duby, Rhonda; Liu, Ning; Olson, Eric N. Deficiency in Kelch protein Klhl31 causes congenital myopathy in mice. The Journal Of Clinical Investigation. 2017;127(10):3730-3740. 

Tucker, Nathan R; McLellan, Micheal A; Hu, Dongjian; Ye, Jiangchuan; Parsons, Victoria A; Mills, Robert W; Clauss, Sebastian; Dolmatova, Elena; Shea, Marisa A; Milan, David J; Scott, Nandita S; Lindsay, Mark; Lubitz, Steven A; Domian, Ibrahim J; Stone, James R; Lin, Honghuang; Ellinor, Patrick T. Novel Mutation in FLNC (Filamin C) Causes Familial Restrictive Cardiomyopathy. Circulation. Cardiovascular Genetics. 2017;10(6)