Anti FLNB pAb (ATL-HPA004886 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004886-25

Protein Description: filamin B, beta
Gene Name: FLNB
Alternative Gene Name: ABP-278, FH1, FLN1L, LRS1, TABP, TAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025278: 92%, ENSRNOG00000009470: 89%
Entrez Gene ID: 2317
Uniprot ID: O75369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTV
• Gene Sequence: HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTV
• Gene ID - Mouse: ENSMUSG00000025278
• Gene ID - Rat: ENSRNOG00000009470
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FLNB pAb (ATL-HPA004886 w/enhanced validation) – 2 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. 

Wiedenmann, Sandra; Breunig, Markus; Merkle, Jessica; von Toerne, Christine; Georgiev, Tihomir; Moussus, Michel; Schulte, Lucas; Seufferlein, Thomas; Sterr, Michael; Lickert, Heiko; Weissinger, Stephanie Ellen; Möller, Peter; Hauck, Stefanie M; Hohwieler, Meike; Kleger, Alexander; Meier, Matthias. Single-cell-resolved differentiation of human induced pluripotent stem cells into pancreatic duct-like organoids on a microwell chip. Nature Biomedical Engineering. 2021;5(8):897-913.