Anti FLNB pAb (ATL-HPA004747 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004747-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FLNB
Alternative Gene Name: ABP-278, FH1, FLN1L, LRS1, TABP, TAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025278: 90%, ENSRNOG00000009470: 89%
Entrez Gene ID: 2317
Uniprot ID: O75369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWG |
| Gene Sequence | KEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWG |
| Gene ID - Mouse | ENSMUSG00000025278 |
| Gene ID - Rat | ENSRNOG00000009470 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FLNB pAb (ATL-HPA004747 w/enhanced validation) | |
| Datasheet | Anti FLNB pAb (ATL-HPA004747 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FLNB pAb (ATL-HPA004747 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FLNB pAb (ATL-HPA004747 w/enhanced validation) | |
| Datasheet | Anti FLNB pAb (ATL-HPA004747 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FLNB pAb (ATL-HPA004747 w/enhanced validation) |
| Citations for Anti FLNB pAb (ATL-HPA004747 w/enhanced validation) – 2 Found |
| Nissou, Marie-France; El Atifi, Michèle; Guttin, Audrey; Godfraind, Catherine; Salon, Caroline; Garcion, Emmanuel; van der Sanden, Boudewijn; Issartel, Jean-Paul; Berger, François; Wion, Didier. Hypoxia-induced expression of VE-cadherin and filamin B in glioma cell cultures and pseudopalisade structures. Journal Of Neuro-Oncology. 2013;113(2):239-49. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |