Gene Name: FLAD1
Alternative Gene Name: FAD1, PP591
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042642: 89%, ENSRNOG00000020642: 89%
Entrez Gene ID: 80308
Uniprot ID: Q8NFF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA |
| Gene Sequence | TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA |
| Gene ID - Mouse | ENSMUSG00000042642 |
| Gene ID - Rat | ENSRNOG00000020642 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FLAD1 pAb (ATL-HPA028486) | |
| Datasheet | Anti FLAD1 pAb (ATL-HPA028486) Datasheet (External Link) |
| Vendor Page | Anti FLAD1 pAb (ATL-HPA028486) at Atlas Antibodies |
| Documents & Links for Anti FLAD1 pAb (ATL-HPA028486) | |
| Datasheet | Anti FLAD1 pAb (ATL-HPA028486) Datasheet (External Link) |
| Vendor Page | Anti FLAD1 pAb (ATL-HPA028486) |