Anti FLAD1 pAb (ATL-HPA028486)

Atlas Antibodies

Catalog No.:
ATL-HPA028486-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: flavin adenine dinucleotide synthetase 1
Gene Name: FLAD1
Alternative Gene Name: FAD1, PP591
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042642: 89%, ENSRNOG00000020642: 89%
Entrez Gene ID: 80308
Uniprot ID: Q8NFF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA
Gene Sequence TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA
Gene ID - Mouse ENSMUSG00000042642
Gene ID - Rat ENSRNOG00000020642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FLAD1 pAb (ATL-HPA028486)
Datasheet Anti FLAD1 pAb (ATL-HPA028486) Datasheet (External Link)
Vendor Page Anti FLAD1 pAb (ATL-HPA028486) at Atlas Antibodies

Documents & Links for Anti FLAD1 pAb (ATL-HPA028486)
Datasheet Anti FLAD1 pAb (ATL-HPA028486) Datasheet (External Link)
Vendor Page Anti FLAD1 pAb (ATL-HPA028486)