Anti FLAD1 pAb (ATL-HPA028486)

Atlas Antibodies

SKU:
ATL-HPA028486-25
  • Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: flavin adenine dinucleotide synthetase 1
Gene Name: FLAD1
Alternative Gene Name: FAD1, PP591
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042642: 89%, ENSRNOG00000020642: 89%
Entrez Gene ID: 80308
Uniprot ID: Q8NFF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA
Gene Sequence TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA
Gene ID - Mouse ENSMUSG00000042642
Gene ID - Rat ENSRNOG00000020642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FLAD1 pAb (ATL-HPA028486)
Datasheet Anti FLAD1 pAb (ATL-HPA028486) Datasheet (External Link)
Vendor Page Anti FLAD1 pAb (ATL-HPA028486) at Atlas Antibodies

Documents & Links for Anti FLAD1 pAb (ATL-HPA028486)
Datasheet Anti FLAD1 pAb (ATL-HPA028486) Datasheet (External Link)
Vendor Page Anti FLAD1 pAb (ATL-HPA028486)