Anti FKBP9 pAb (ATL-HPA012595)

Atlas Antibodies

SKU: ATL-HPA012595-100

• 
• 
• 

Protein Description: FK506 binding protein 9, 63 kDa
Gene Name: FKBP9
Alternative Gene Name: FKBP60, FKBP63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029781: 90%, ENSRNOG00000005478: 92%
Entrez Gene ID: 11328
Uniprot ID: O95302
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDF
• Gene Sequence: TGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDF
• Gene ID - Mouse: ENSMUSG00000029781
• Gene ID - Rat: ENSRNOG00000005478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.