Anti FKBP8 pAb (ATL-HPA045177)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045177-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: FKBP8
Alternative Gene Name: FKBP38, FKBPr38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019428: 95%, ENSRNOG00000058359: 96%
Entrez Gene ID: 23770
Uniprot ID: Q14318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGK |
Gene ID - Mouse | ENSMUSG00000019428 |
Gene ID - Rat | ENSMUSG00000019428 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FKBP8 pAb (ATL-HPA045177) | |
Datasheet | Anti FKBP8 pAb (ATL-HPA045177) Datasheet (External Link) |
Vendor Page | Anti FKBP8 pAb (ATL-HPA045177) at Atlas Antibodies |
Documents & Links for Anti FKBP8 pAb (ATL-HPA045177) | |
Datasheet | Anti FKBP8 pAb (ATL-HPA045177) Datasheet (External Link) |
Vendor Page | Anti FKBP8 pAb (ATL-HPA045177) |