Anti FKBP8 pAb (ATL-HPA045177)

Atlas Antibodies

Catalog No.:
ATL-HPA045177-100
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and in neuropil.
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & mitochondria.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: FK506 binding protein 8, 38kDa
Gene Name: FKBP8
Alternative Gene Name: FKBP38, FKBPr38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019428: 95%, ENSRNOG00000058359: 96%
Entrez Gene ID: 23770
Uniprot ID: Q14318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence YDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGK
Gene ID - Mouse ENSMUSG00000019428
Gene ID - Rat ENSMUSG00000019428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FKBP8 pAb (ATL-HPA045177)
Datasheet Anti FKBP8 pAb (ATL-HPA045177) Datasheet (External Link)
Vendor Page Anti FKBP8 pAb (ATL-HPA045177) at Atlas Antibodies

Documents & Links for Anti FKBP8 pAb (ATL-HPA045177)
Datasheet Anti FKBP8 pAb (ATL-HPA045177) Datasheet (External Link)
Vendor Page Anti FKBP8 pAb (ATL-HPA045177)
!