Anti FKBP5 pAb (ATL-HPA031095)

Atlas Antibodies

SKU: ATL-HPA031095-25

• 
• 

Protein Description: FK506 binding protein 5
Gene Name: FKBP5
Alternative Gene Name: FKBP51, FKBP54, P54, PPIase, Ptg-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024222: 76%, ENSRNOG00000022523: 87%
Entrez Gene ID: 2289
Uniprot ID: Q13451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNG
• Gene Sequence: TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNG
• Gene ID - Mouse: ENSMUSG00000024222
• Gene ID - Rat: ENSRNOG00000022523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.