Anti FKBP5 pAb (ATL-HPA031095)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031095-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FKBP5
Alternative Gene Name: FKBP51, FKBP54, P54, PPIase, Ptg-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024222: 76%, ENSRNOG00000022523: 87%
Entrez Gene ID: 2289
Uniprot ID: Q13451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNG |
| Gene Sequence | TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNG |
| Gene ID - Mouse | ENSMUSG00000024222 |
| Gene ID - Rat | ENSRNOG00000022523 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FKBP5 pAb (ATL-HPA031095) | |
| Datasheet | Anti FKBP5 pAb (ATL-HPA031095) Datasheet (External Link) |
| Vendor Page | Anti FKBP5 pAb (ATL-HPA031095) at Atlas Antibodies |
| Documents & Links for Anti FKBP5 pAb (ATL-HPA031095) | |
| Datasheet | Anti FKBP5 pAb (ATL-HPA031095) Datasheet (External Link) |
| Vendor Page | Anti FKBP5 pAb (ATL-HPA031095) |