Anti FKBP5 pAb (ATL-HPA031095)

Atlas Antibodies

Catalog No.:
ATL-HPA031095-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: FK506 binding protein 5
Gene Name: FKBP5
Alternative Gene Name: FKBP51, FKBP54, P54, PPIase, Ptg-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024222: 76%, ENSRNOG00000022523: 87%
Entrez Gene ID: 2289
Uniprot ID: Q13451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNG
Gene Sequence TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNG
Gene ID - Mouse ENSMUSG00000024222
Gene ID - Rat ENSRNOG00000022523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FKBP5 pAb (ATL-HPA031095)
Datasheet Anti FKBP5 pAb (ATL-HPA031095) Datasheet (External Link)
Vendor Page Anti FKBP5 pAb (ATL-HPA031095) at Atlas Antibodies

Documents & Links for Anti FKBP5 pAb (ATL-HPA031095)
Datasheet Anti FKBP5 pAb (ATL-HPA031095) Datasheet (External Link)
Vendor Page Anti FKBP5 pAb (ATL-HPA031095)