Anti FKBP5 pAb (ATL-HPA031092 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031092-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: FKBP5
Alternative Gene Name: FKBP51, FKBP54, P54, PPIase, Ptg-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024222: 90%, ENSRNOG00000022523: 90%
Entrez Gene ID: 2289
Uniprot ID: Q13451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP |
Gene Sequence | RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP |
Gene ID - Mouse | ENSMUSG00000024222 |
Gene ID - Rat | ENSRNOG00000022523 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FKBP5 pAb (ATL-HPA031092 w/enhanced validation) | |
Datasheet | Anti FKBP5 pAb (ATL-HPA031092 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FKBP5 pAb (ATL-HPA031092 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FKBP5 pAb (ATL-HPA031092 w/enhanced validation) | |
Datasheet | Anti FKBP5 pAb (ATL-HPA031092 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FKBP5 pAb (ATL-HPA031092 w/enhanced validation) |