Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA006148-25

• 
• 
• 

Protein Description: FK506 binding protein 4, 59kDa
Gene Name: FKBP4
Alternative Gene Name: FKBP52, FKBP59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030357: 89%, ENSRNOG00000006444: 89%
Entrez Gene ID: 2288
Uniprot ID: Q02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGE
• Gene Sequence: IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGE
• Gene ID - Mouse: ENSMUSG00000030357
• Gene ID - Rat: ENSRNOG00000006444
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation) – 1 Found

Tyleckova, Jirina; Hrabakova, Rita; Mairychova, Katerina; Halada, Petr; Radova, Lenka; Dzubak, Petr; Hajduch, Marian; Gadher, Suresh J; Kovarova, Hana. Cancer cell response to anthracyclines effects: mysteries of the hidden proteins associated with these drugs. International Journal Of Molecular Sciences. 2012;13(12):15536-64.