Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006148-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FKBP4
Alternative Gene Name: FKBP52, FKBP59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030357: 89%, ENSRNOG00000006444: 89%
Entrez Gene ID: 2288
Uniprot ID: Q02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGE |
| Gene Sequence | IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGE |
| Gene ID - Mouse | ENSMUSG00000030357 |
| Gene ID - Rat | ENSRNOG00000006444 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation) | |
| Datasheet | Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation) | |
| Datasheet | Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation) |
| Citations for Anti FKBP4 pAb (ATL-HPA006148 w/enhanced validation) – 1 Found |
| Tyleckova, Jirina; Hrabakova, Rita; Mairychova, Katerina; Halada, Petr; Radova, Lenka; Dzubak, Petr; Hajduch, Marian; Gadher, Suresh J; Kovarova, Hana. Cancer cell response to anthracyclines effects: mysteries of the hidden proteins associated with these drugs. International Journal Of Molecular Sciences. 2012;13(12):15536-64. PubMed |