Anti FKBP3 pAb (ATL-HPA000864)

Atlas Antibodies

Catalog No.:
ATL-HPA000864-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FK506 binding protein 3, 25kDa
Gene Name: FKBP3
Alternative Gene Name: FKBP-25, PPIase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020949: 92%, ENSRNOG00000004629: 94%
Entrez Gene ID: 2287
Uniprot ID: Q00688
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGT
Gene Sequence LPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGT
Gene ID - Mouse ENSMUSG00000020949
Gene ID - Rat ENSRNOG00000004629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FKBP3 pAb (ATL-HPA000864)
Datasheet Anti FKBP3 pAb (ATL-HPA000864) Datasheet (External Link)
Vendor Page Anti FKBP3 pAb (ATL-HPA000864) at Atlas Antibodies

Documents & Links for Anti FKBP3 pAb (ATL-HPA000864)
Datasheet Anti FKBP3 pAb (ATL-HPA000864) Datasheet (External Link)
Vendor Page Anti FKBP3 pAb (ATL-HPA000864)