Anti FKBP3 pAb (ATL-HPA000864)
Atlas Antibodies
- SKU:
- ATL-HPA000864-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FKBP3
Alternative Gene Name: FKBP-25, PPIase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020949: 92%, ENSRNOG00000004629: 94%
Entrez Gene ID: 2287
Uniprot ID: Q00688
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGT |
Gene Sequence | LPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGT |
Gene ID - Mouse | ENSMUSG00000020949 |
Gene ID - Rat | ENSRNOG00000004629 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FKBP3 pAb (ATL-HPA000864) | |
Datasheet | Anti FKBP3 pAb (ATL-HPA000864) Datasheet (External Link) |
Vendor Page | Anti FKBP3 pAb (ATL-HPA000864) at Atlas Antibodies |
Documents & Links for Anti FKBP3 pAb (ATL-HPA000864) | |
Datasheet | Anti FKBP3 pAb (ATL-HPA000864) Datasheet (External Link) |
Vendor Page | Anti FKBP3 pAb (ATL-HPA000864) |