Anti FKBP1A pAb (ATL-HPA051798)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051798-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: FKBP1A
Alternative Gene Name: FKBP-12, FKBP1, FKBP12, FKBP12C, PKC12, PPIASE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032966: 100%, ENSRNOG00000008822: 97%
Entrez Gene ID: 2280
Uniprot ID: P62942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD |
| Gene Sequence | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD |
| Gene ID - Mouse | ENSMUSG00000032966 |
| Gene ID - Rat | ENSRNOG00000008822 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FKBP1A pAb (ATL-HPA051798) | |
| Datasheet | Anti FKBP1A pAb (ATL-HPA051798) Datasheet (External Link) |
| Vendor Page | Anti FKBP1A pAb (ATL-HPA051798) at Atlas Antibodies |
| Documents & Links for Anti FKBP1A pAb (ATL-HPA051798) | |
| Datasheet | Anti FKBP1A pAb (ATL-HPA051798) Datasheet (External Link) |
| Vendor Page | Anti FKBP1A pAb (ATL-HPA051798) |