Anti FKBP15 pAb (ATL-HPA007979)

Atlas Antibodies

SKU: ATL-HPA007979-25

• 
• 

Protein Description: FK506 binding protein 15, 133kDa
Gene Name: FKBP15
Alternative Gene Name: FKBP133, KIAA0674, PPP1R76, WAFL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066151: 95%, ENSRNOG00000024663: 94%
Entrez Gene ID: 23307
Uniprot ID: Q5T1M5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ
• Gene Sequence: KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ
• Gene ID - Mouse: ENSMUSG00000066151
• Gene ID - Rat: ENSRNOG00000024663
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FKBP15 pAb (ATL-HPA007979) – 2 Found

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Pan, You Fu; Viklund, Ing-Marie; Tsai, Heng Hang; Pettersson, Sven; Maruyama, Ichiro N. The ulcerative colitis marker protein WAFL interacts with accessory proteins in endocytosis. International Journal Of Biological Sciences. 2010;6(2):163-71.