Anti FKBP15 pAb (ATL-HPA007979)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007979-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FKBP15
Alternative Gene Name: FKBP133, KIAA0674, PPP1R76, WAFL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066151: 95%, ENSRNOG00000024663: 94%
Entrez Gene ID: 23307
Uniprot ID: Q5T1M5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ |
| Gene Sequence | KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ |
| Gene ID - Mouse | ENSMUSG00000066151 |
| Gene ID - Rat | ENSRNOG00000024663 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FKBP15 pAb (ATL-HPA007979) | |
| Datasheet | Anti FKBP15 pAb (ATL-HPA007979) Datasheet (External Link) |
| Vendor Page | Anti FKBP15 pAb (ATL-HPA007979) at Atlas Antibodies |
| Documents & Links for Anti FKBP15 pAb (ATL-HPA007979) | |
| Datasheet | Anti FKBP15 pAb (ATL-HPA007979) Datasheet (External Link) |
| Vendor Page | Anti FKBP15 pAb (ATL-HPA007979) |
| Citations for Anti FKBP15 pAb (ATL-HPA007979) – 2 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Pan, You Fu; Viklund, Ing-Marie; Tsai, Heng Hang; Pettersson, Sven; Maruyama, Ichiro N. The ulcerative colitis marker protein WAFL interacts with accessory proteins in endocytosis. International Journal Of Biological Sciences. 2010;6(2):163-71. PubMed |