Anti FKBP14 pAb (ATL-HPA026829)
Atlas Antibodies
- SKU:
- ATL-HPA026829-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FKBP14
Alternative Gene Name: FKBP22, FLJ20731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038074: 97%, ENSRNOG00000057016: 97%
Entrez Gene ID: 55033
Uniprot ID: Q9NWM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG |
Gene Sequence | ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG |
Gene ID - Mouse | ENSMUSG00000038074 |
Gene ID - Rat | ENSRNOG00000057016 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FKBP14 pAb (ATL-HPA026829) | |
Datasheet | Anti FKBP14 pAb (ATL-HPA026829) Datasheet (External Link) |
Vendor Page | Anti FKBP14 pAb (ATL-HPA026829) at Atlas Antibodies |
Documents & Links for Anti FKBP14 pAb (ATL-HPA026829) | |
Datasheet | Anti FKBP14 pAb (ATL-HPA026829) Datasheet (External Link) |
Vendor Page | Anti FKBP14 pAb (ATL-HPA026829) |