Anti FKBP14 pAb (ATL-HPA026829)

Atlas Antibodies

SKU: ATL-HPA026829-25

• 

Protein Description: FK506 binding protein 14, 22 kDa
Gene Name: FKBP14
Alternative Gene Name: FKBP22, FLJ20731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038074: 97%, ENSRNOG00000057016: 97%
Entrez Gene ID: 55033
Uniprot ID: Q9NWM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG
• Gene Sequence: ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG
• Gene ID - Mouse: ENSMUSG00000038074
• Gene ID - Rat: ENSRNOG00000057016
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.