Anti FKBP14 pAb (ATL-HPA026829)

Atlas Antibodies

Catalog No.:
ATL-HPA026829-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: FK506 binding protein 14, 22 kDa
Gene Name: FKBP14
Alternative Gene Name: FKBP22, FLJ20731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038074: 97%, ENSRNOG00000057016: 97%
Entrez Gene ID: 55033
Uniprot ID: Q9NWM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG
Gene Sequence ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG
Gene ID - Mouse ENSMUSG00000038074
Gene ID - Rat ENSRNOG00000057016
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FKBP14 pAb (ATL-HPA026829)
Datasheet Anti FKBP14 pAb (ATL-HPA026829) Datasheet (External Link)
Vendor Page Anti FKBP14 pAb (ATL-HPA026829) at Atlas Antibodies

Documents & Links for Anti FKBP14 pAb (ATL-HPA026829)
Datasheet Anti FKBP14 pAb (ATL-HPA026829) Datasheet (External Link)
Vendor Page Anti FKBP14 pAb (ATL-HPA026829)