Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041709-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FKBP11
Alternative Gene Name: FKBP19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003355: 90%, ENSRNOG00000054775: 89%
Entrez Gene ID: 51303
Uniprot ID: Q9NYL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG |
Gene Sequence | EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG |
Gene ID - Mouse | ENSMUSG00000003355 |
Gene ID - Rat | ENSRNOG00000054775 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) | |
Datasheet | Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) | |
Datasheet | Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) |
Citations for Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) – 1 Found |
Li, Kunping; Li, Yuqing; Lyu, Yinfeng; Tan, Linyi; Zheng, Xinyi; Jiang, Haowen; Wen, Hui; Feng, Chenchen. Development of a Phagocytosis-Dependent Gene Signature to Predict Prognosis and Response to Checkpoint Inhibition in Clear-Cell Renal Cell Carcinoma. Frontiers In Immunology. 13( 35651604):853088. PubMed |