Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041709-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: FK506 binding protein 11, 19 kDa
Gene Name: FKBP11
Alternative Gene Name: FKBP19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003355: 90%, ENSRNOG00000054775: 89%
Entrez Gene ID: 51303
Uniprot ID: Q9NYL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG
Gene Sequence EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG
Gene ID - Mouse ENSMUSG00000003355
Gene ID - Rat ENSRNOG00000054775
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation)
Datasheet Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation)
Datasheet Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation)
Citations for Anti FKBP11 pAb (ATL-HPA041709 w/enhanced validation) – 1 Found
Li, Kunping; Li, Yuqing; Lyu, Yinfeng; Tan, Linyi; Zheng, Xinyi; Jiang, Haowen; Wen, Hui; Feng, Chenchen. Development of a Phagocytosis-Dependent Gene Signature to Predict Prognosis and Response to Checkpoint Inhibition in Clear-Cell Renal Cell Carcinoma. Frontiers In Immunology. 13( 35651604):853088.  PubMed