Anti FITM1 pAb (ATL-HPA019842)

Atlas Antibodies

Catalog No.: ATL-HPA019842-25

Protein Description: fat storage-inducing transmembrane protein 1
Gene Name: FITM1
Alternative Gene Name: FIT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022215: 99%, ENSRNOG00000019019: 99%
Entrez Gene ID: 161247
Uniprot ID: A5D6W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTF
• Gene ID - Mouse: ENSMUSG00000022215
• Gene ID - Rat: ENSMUSG00000022215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FITM1 pAb (ATL-HPA019842) – 1 Found

Mormeneo, Emma; Jimenez-Mallebrera, Cecilia; Palomer, Xavier; De Nigris, Valeria; Vázquez-Carrera, Manuel; Orozco, Anna; Nascimento, Andrés; Colomer, Jaume; Lerín, Carles; Gómez-Foix, Anna M. PGC-1α induces mitochondrial and myokine transcriptional programs and lipid droplet and glycogen accumulation in cultured human skeletal muscle cells. Plos One. 7(1):e29985.