Anti FITM1 pAb (ATL-HPA019842)

Atlas Antibodies

Catalog No.:
ATL-HPA019842-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fat storage-inducing transmembrane protein 1
Gene Name: FITM1
Alternative Gene Name: FIT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022215: 99%, ENSRNOG00000019019: 99%
Entrez Gene ID: 161247
Uniprot ID: A5D6W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTF
Gene ID - Mouse ENSMUSG00000022215
Gene ID - Rat ENSMUSG00000022215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FITM1 pAb (ATL-HPA019842)
Datasheet Anti FITM1 pAb (ATL-HPA019842) Datasheet (External Link)
Vendor Page Anti FITM1 pAb (ATL-HPA019842) at Atlas Antibodies

Documents & Links for Anti FITM1 pAb (ATL-HPA019842)
Datasheet Anti FITM1 pAb (ATL-HPA019842) Datasheet (External Link)
Vendor Page Anti FITM1 pAb (ATL-HPA019842)
Citations for Anti FITM1 pAb (ATL-HPA019842) – 1 Found
Mormeneo, Emma; Jimenez-Mallebrera, Cecilia; Palomer, Xavier; De Nigris, Valeria; Vázquez-Carrera, Manuel; Orozco, Anna; Nascimento, Andrés; Colomer, Jaume; Lerín, Carles; Gómez-Foix, Anna M. PGC-1α induces mitochondrial and myokine transcriptional programs and lipid droplet and glycogen accumulation in cultured human skeletal muscle cells. Plos One. 7(1):e29985.  PubMed