Anti FIS1 pAb (ATL-HPA017430 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017430-25

Protein Description: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Gene Name: FIS1
Alternative Gene Name: CGI-135, Fis1, H_NH0132A01.6, TTC11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019054: 95%, ENSRNOG00000001420: 96%
Entrez Gene ID: 51024
Uniprot ID: Q9Y3D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
• Gene Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
• Gene ID - Mouse: ENSMUSG00000019054
• Gene ID - Rat: ENSRNOG00000001420
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FIS1 pAb (ATL-HPA017430 w/enhanced validation) – 11 Found

Lauritzen, Knut H; Hasan-Olive, Md Mahdi; Regnell, Christine E; Kleppa, Liv; Scheibye-Knudsen, Morten; Gjedde, Albert; Klungland, Arne; Bohr, Vilhelm A; Storm-Mathisen, Jon; Bergersen, Linda H. A ketogenic diet accelerates neurodegeneration in mice with induced mitochondrial DNA toxicity in the forebrain. Neurobiology Of Aging. 2016;48( 27639119):34-47. 

Stocks, Ben; Dent, Jessica R; Joanisse, Sophie; McCurdy, Carrie E; Philp, Andrew. Skeletal Muscle Fibre-Specific Knockout of p53 Does Not Reduce Mitochondrial Content or Enzyme Activity. Frontiers In Physiology. 8( 29255419):941. 

O'Rourke, Allison R; Lindsay, Angus; Tarpey, Michael D; Yuen, Samantha; McCourt, Preston; Nelson, D'anna M; Perrin, Benjamin J; Thomas, David D; Spangenburg, Espen E; Lowe, Dawn A; Ervasti, James M. Impaired muscle relaxation and mitochondrial fission associated with genetic ablation of cytoplasmic actin isoforms. The Febs Journal. 2018;285(3):481-500. 

Lobet, Elodie; Willemart, Kevin; Ninane, Noëlle; Demazy, Catherine; Sedzicki, Jaroslaw; Lelubre, Christophe; De Bolle, Xavier; Renard, Patricia; Raes, Martine; Dehio, Christoph; Letesson, Jean-Jacques; Arnould, Thierry. Mitochondrial fragmentation affects neither the sensitivity to TNFα-induced apoptosis of Brucella-infected cells nor the intracellular replication of the bacteria. Scientific Reports. 2018;8(1):5173. 

Van Beersel, Guillaume; Tihon, Eliane; Demine, Stéphane; Hamer, Isabelle; Jadot, Michel; Arnould, Thierry. Different molecular mechanisms involved in spontaneous and oxidative stress-induced mitochondrial fragmentation in tripeptidyl peptidase-1 (TPP-1)-deficient fibroblasts. Bioscience Reports. 2013;33(2):e00023. 

Ashcroft, Stephen P; Bass, Joseph J; Kazi, Abid A; Atherton, Philip J; Philp, Andrew. The vitamin D receptor regulates mitochondrial function in C2C12 myoblasts. American Journal Of Physiology. Cell Physiology. 2020;318(3):C536-C541. 

Bhupana, Jagannatham Naidu; Huang, Bo-Tsang; Liou, Gunn-Guang; Calkins, Marcus J; Lin-Chao, Sue. Gas7 knockout affects PINK1 expression and mitochondrial dynamics in mouse cortical neurons. Faseb Bioadvances. 2020;2(3):166-181. 

Schiavon, Cara R; Zhang, Tong; Zhao, Bing; Moore, Andrew S; Wales, Pauline; Andrade, Leonardo R; Wu, Melissa; Sung, Tsung-Chang; Dayn, Yelena; Feng, Jasmine W; Quintero, Omar A; Shadel, Gerald S; Grosse, Robert; Manor, Uri. Actin chromobody imaging reveals sub-organellar actin dynamics. Nature Methods. 2020;17(9):917-921. 

Simpson, Cory L; Tokito, Mariko K; Uppala, Ranjitha; Sarkar, Mrinal K; Gudjonsson, Johann E; Holzbaur, Erika L F. NIX initiates mitochondrial fragmentation via DRP1 to drive epidermal differentiation. Cell Reports. 2021;34(5):108689. 

Yu, Rong; Liu, Tong; Jin, Shao-Bo; Ankarcrona, Maria; Lendahl, Urban; Nistér, Monica; Zhao, Jian. MIEF1/2 orchestrate mitochondrial dynamics through direct engagement with both the fission and fusion machineries. Bmc Biology. 2021;19(1):229. 

Marshall, Ryan Neil; McKendry, James; Smeuninx, Benoit; Seabright, Alex Peter; Morgan, Paul T; Greig, Carolyn; Breen, Leigh. Acute resistance exercise training does not augment mitochondrial remodelling in master athletes or untrained older adults. Frontiers In Physiology. 13( 36685204):1097988.