Anti FIP1L1 pAb (ATL-HPA037475)

Atlas Antibodies

SKU: ATL-HPA037475-25

• 
• 
• 

Protein Description: factor interacting with PAPOLA and CPSF1
Gene Name: FIP1L1
Alternative Gene Name: DKFZp586K0717, FIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029227: 98%, ENSRNOG00000002275: 98%
Entrez Gene ID: 81608
Uniprot ID: Q6UN15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KANSSVGKWQDRYGRAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFFPPGAPPT
• Gene Sequence: KANSSVGKWQDRYGRAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFFPPGAPPT
• Gene ID - Mouse: ENSMUSG00000029227
• Gene ID - Rat: ENSRNOG00000002275
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FIP1L1 pAb (ATL-HPA037475) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.