Anti FHOD1 pAb (ATL-HPA024468)
Atlas Antibodies
- SKU:
- ATL-HPA024468-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FHOD1
Alternative Gene Name: FHOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014778: 65%, ENSRNOG00000054625: 58%
Entrez Gene ID: 29109
Uniprot ID: Q9Y613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP |
Gene Sequence | AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP |
Gene ID - Mouse | ENSMUSG00000014778 |
Gene ID - Rat | ENSRNOG00000054625 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FHOD1 pAb (ATL-HPA024468) | |
Datasheet | Anti FHOD1 pAb (ATL-HPA024468) Datasheet (External Link) |
Vendor Page | Anti FHOD1 pAb (ATL-HPA024468) at Atlas Antibodies |
Documents & Links for Anti FHOD1 pAb (ATL-HPA024468) | |
Datasheet | Anti FHOD1 pAb (ATL-HPA024468) Datasheet (External Link) |
Vendor Page | Anti FHOD1 pAb (ATL-HPA024468) |
Citations for Anti FHOD1 pAb (ATL-HPA024468) – 4 Found |
Heuser, Vanina D; Mansuri, Naziha; Mogg, Jasper; Kurki, Samu; Repo, Heli; Kronqvist, Pauliina; Carpén, Olli; Gardberg, Maria. Formin Proteins FHOD1 and INF2 in Triple-Negative Breast Cancer: Association With Basal Markers and Functional Activities. Breast Cancer : Basic And Clinical Research. 12( 30158824):1178223418792247. PubMed |
Mansuri, Naziha; Heuser, Vanina D; Birkman, Eva-Maria; Lintunen, Minnamaija; Ålgars, Annika; Sundström, Jari; Ristamäki, Raija; Carpén, Olli; Lehtinen, Laura. FHOD1 and FMNL1 formin proteins in intestinal gastric cancer: correlation with tumor-infiltrating T lymphocytes and molecular subtypes. Gastric Cancer : Official Journal Of The International Gastric Cancer Association And The Japanese Gastric Cancer Association. 2021;24(6):1254-1263. PubMed |
Gardberg, Maria; Kaipio, Katja; Lehtinen, Laura; Mikkonen, Piia; Heuser, Vanina D; Talvinen, Kati; Iljin, Kristiina; Kampf, Caroline; Uhlen, Mathias; Grénman, Reidar; Koivisto, Mari; Carpén, Olli. FHOD1, a formin upregulated in epithelial-mesenchymal transition, participates in cancer cell migration and invasion. Plos One. 8(9):e74923. PubMed |
Heuser, Vanina D; Kiviniemi, Aida; Lehtinen, Laura; Munthe, Sune; Kristensen, Bjarne Winther; Posti, Jussi P; Sipilä, Jussi O T; Vuorinen, Ville; Carpén, Olli; Gardberg, Maria. Multiple formin proteins participate in glioblastoma migration. Bmc Cancer. 2020;20(1):710. PubMed |