Anti FHL2 pAb (ATL-HPA006028 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA006028-25

• 
• 
• 

Protein Description: four and a half LIM domains 2
Gene Name: FHL2
Alternative Gene Name: DRAL, SLIM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008136: 89%, ENSRNOG00000016866: 89%
Entrez Gene ID: 2274
Uniprot ID: Q14192
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSS
• Gene Sequence: RFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSS
• Gene ID - Mouse: ENSMUSG00000008136
• Gene ID - Rat: ENSRNOG00000016866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FHL2 pAb (ATL-HPA006028 w/enhanced validation) – 6 Found

Nakazawa, Naotaka; Sathe, Aneesh R; Shivashankar, G V; Sheetz, Michael P. Matrix mechanics controls FHL2 movement to the nucleus to activate p21 expression. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(44):E6813-E6822. 

Maier, Jasmin I; Rogg, Manuel; Helmstädter, Martin; Sammarco, Alena; Walz, Gerd; Werner, Martin; Schell, Christoph. A Novel Model for Nephrotic Syndrome Reveals Associated Dysbiosis of the Gut Microbiome and Extramedullary Hematopoiesis. Cells. 2021;10(6) 

Basu, Himanish; Pekkurnaz, Gulcin; Falk, Jill; Wei, Wei; Chin, Morven; Steen, Judith; Schwarz, Thomas L. FHL2 anchors mitochondria to actin and adapts mitochondrial dynamics to glucose supply. The Journal Of Cell Biology. 2021;220(10) 

Pontén, Fredrik; Gry, Marcus; Fagerberg, Linn; Lundberg, Emma; Asplund, Anna; Berglund, Lisa; Oksvold, Per; Björling, Erik; Hober, Sophia; Kampf, Caroline; Navani, Sanjay; Nilsson, Peter; Ottosson, Jenny; Persson, Anja; Wernérus, Henrik; Wester, Kenneth; Uhlén, Mathias. A global view of protein expression in human cells, tissues, and organs. Molecular Systems Biology. 5( 20029370):337. 

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.