Anti FHIT pAb (ATL-HPA018909 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018909-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FHIT
Alternative Gene Name: AP3Aase, FRA3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060579: 85%, ENSRNOG00000038140: 28%
Entrez Gene ID: 2272
Uniprot ID: P49789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEA |
Gene Sequence | GTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEA |
Gene ID - Mouse | ENSMUSG00000060579 |
Gene ID - Rat | ENSRNOG00000038140 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FHIT pAb (ATL-HPA018909 w/enhanced validation) | |
Datasheet | Anti FHIT pAb (ATL-HPA018909 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FHIT pAb (ATL-HPA018909 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FHIT pAb (ATL-HPA018909 w/enhanced validation) | |
Datasheet | Anti FHIT pAb (ATL-HPA018909 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FHIT pAb (ATL-HPA018909 w/enhanced validation) |