Anti FHIT pAb (ATL-HPA018909 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018909-25

• 
• 

Protein Description: fragile histidine triad
Gene Name: FHIT
Alternative Gene Name: AP3Aase, FRA3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060579: 85%, ENSRNOG00000038140: 28%
Entrez Gene ID: 2272
Uniprot ID: P49789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEA
• Gene Sequence: GTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEA
• Gene ID - Mouse: ENSMUSG00000060579
• Gene ID - Rat: ENSRNOG00000038140
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.