Anti FHIT pAb (ATL-HPA018840 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018840-100

Protein Description: fragile histidine triad
Gene Name: FHIT
Alternative Gene Name: AP3Aase, FRA3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060579: 96%, ENSRNOG00000002104: 28%
Entrez Gene ID: 2272
Uniprot ID: P49789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
• Gene Sequence: FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
• Gene ID - Mouse: ENSMUSG00000060579
• Gene ID - Rat: ENSRNOG00000002104
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FHIT pAb (ATL-HPA018840 w/enhanced validation) – 2 Found

Diaz, Roberto Jose; Guduk, Mustafa; Romagnuolo, Rocco; Smith, Christian A; Northcott, Paul; Shih, David; Berisha, Fitim; Flanagan, Adrienne; Munoz, David G; Cusimano, Michael D; Pamir, M Necmettin; Rutka, James T. High-resolution whole-genome analysis of skull base chordomas implicates FHIT loss in chordoma pathogenesis. Neoplasia (New York, N.y.). 2012;14(9):788-98. 

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300.