Anti FH pAb (ATL-HPA025948 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA025948-100
  • Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400053).
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: fumarate hydratase
Gene Name: FH
Alternative Gene Name: fumarase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026526: 99%, ENSRNOG00000003653: 100%
Entrez Gene ID: 2271
Uniprot ID: P07954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVM
Gene Sequence KFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVM
Gene ID - Mouse ENSMUSG00000026526
Gene ID - Rat ENSRNOG00000003653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FH pAb (ATL-HPA025948 w/enhanced validation)
Datasheet Anti FH pAb (ATL-HPA025948 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FH pAb (ATL-HPA025948 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FH pAb (ATL-HPA025948 w/enhanced validation)
Datasheet Anti FH pAb (ATL-HPA025948 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FH pAb (ATL-HPA025948 w/enhanced validation)