Anti FGL2 pAb (ATL-HPA026682 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA026682-25

• 

Protein Description: fibrinogen-like 2
Gene Name: FGL2
Alternative Gene Name: pT49, T49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039899: 84%, ENSRNOG00000012881: 85%
Entrez Gene ID: 10875
Uniprot ID: Q14314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR
• Gene Sequence: SQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR
• Gene ID - Mouse: ENSMUSG00000039899
• Gene ID - Rat: ENSRNOG00000012881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FGL2 pAb (ATL-HPA026682 w/enhanced validation) – 1 Found

Sparreman Mikus, Maria; Kolmert, Johan; Andersson, Lars I; Östling, Jörgen; Knowles, Richard G; Gómez, Cristina; Ericsson, Magnus; Thörngren, John-Olof; Emami Khoonsari, Payam; Dahlén, Barbro; Kupczyk, Maciej; De Meulder, Bertrand; Auffray, Charles; Bakke, Per S; Beghe, Bianca; Bel, Elisabeth H; Caruso, Massimo; Chanez, Pascal; Chawes, Bo; Fowler, Stephen J; Gaga, Mina; Geiser, Thomas; Gjomarkaj, Mark; Horváth, Ildikó; Howarth, Peter H; Johnston, Sebastian L; Joos, Guy; Krug, Norbert; Montuschi, Paolo; Musial, Jacek; Niżankowska-Mogilnicka, Ewa; Olsson, Henric K; Papi, Alberto; Rabe, Klaus F; Sandström, Thomas; Shaw, Dominick E; Siafakas, Nikolaos M; Uhlén, Mathias; Riley, John H; Bates, Stewart; Middelveld, Roelinde J M; Wheelock, Craig E; Chung, Kian Fan; Adcock, Ian M; Sterk, Peter J; Djukanovic, Ratko; Nilsson, Peter; Dahlén, Sven-Erik; James, Anna. Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammation. The European Respiratory Journal. 2022;59(2)