Anti FGL2 pAb (ATL-HPA021011 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021011-100

Protein Description: fibrinogen-like 2
Gene Name: FGL2
Alternative Gene Name: pT49, T49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039899: 67%, ENSRNOG00000012881: 68%
Entrez Gene ID: 10875
Uniprot ID: Q14314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCP
• Gene Sequence: RNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCP
• Gene ID - Mouse: ENSMUSG00000039899
• Gene ID - Rat: ENSRNOG00000012881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FGL2 pAb (ATL-HPA021011 w/enhanced validation) – 1 Found

Pulkka, Olli-Pekka; Viisanen, Leevi; Tynninen, Olli; Laaksonen, Maria; Reichardt, Peter; Reichardt, Annette; Eriksson, Mikael; Hall, Kirsten Sundby; Wardelmann, Eva; Nilsson, Bengt; Sihto, Harri; Joensuu, Heikki. Fibrinogen-like protein 2 in gastrointestinal stromal tumour. Journal Of Cellular And Molecular Medicine. 2022;26(4):1083-1094.