Anti FGFR4 pAb (ATL-HPA027369)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027369-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FGFR4
Alternative Gene Name: CD334, JTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005320: 79%, ENSRNOG00000016763: 77%
Entrez Gene ID: 2264
Uniprot ID: P22455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGN |
Gene Sequence | TGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGN |
Gene ID - Mouse | ENSMUSG00000005320 |
Gene ID - Rat | ENSRNOG00000016763 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FGFR4 pAb (ATL-HPA027369) | |
Datasheet | Anti FGFR4 pAb (ATL-HPA027369) Datasheet (External Link) |
Vendor Page | Anti FGFR4 pAb (ATL-HPA027369) at Atlas Antibodies |
Documents & Links for Anti FGFR4 pAb (ATL-HPA027369) | |
Datasheet | Anti FGFR4 pAb (ATL-HPA027369) Datasheet (External Link) |
Vendor Page | Anti FGFR4 pAb (ATL-HPA027369) |
Citations for Anti FGFR4 pAb (ATL-HPA027369) – 1 Found |
Narisawa, Takafumi; Naito, Sei; Ito, Hiromi; Ichiyanagi, Osamu; Sakurai, Toshihiko; Kato, Tomoyuki; Tsuchiya, Norihiko. Fibroblast growth factor receptor type 4 as a potential therapeutic target in clear cell renal cell carcinoma. Bmc Cancer. 2023;23(1):170. PubMed |