Anti FGFR4 pAb (ATL-HPA027369)

Atlas Antibodies

Catalog No.:
ATL-HPA027369-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor receptor 4
Gene Name: FGFR4
Alternative Gene Name: CD334, JTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005320: 79%, ENSRNOG00000016763: 77%
Entrez Gene ID: 2264
Uniprot ID: P22455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGN
Gene Sequence TGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGN
Gene ID - Mouse ENSMUSG00000005320
Gene ID - Rat ENSRNOG00000016763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGFR4 pAb (ATL-HPA027369)
Datasheet Anti FGFR4 pAb (ATL-HPA027369) Datasheet (External Link)
Vendor Page Anti FGFR4 pAb (ATL-HPA027369) at Atlas Antibodies

Documents & Links for Anti FGFR4 pAb (ATL-HPA027369)
Datasheet Anti FGFR4 pAb (ATL-HPA027369) Datasheet (External Link)
Vendor Page Anti FGFR4 pAb (ATL-HPA027369)
Citations for Anti FGFR4 pAb (ATL-HPA027369) – 1 Found
Narisawa, Takafumi; Naito, Sei; Ito, Hiromi; Ichiyanagi, Osamu; Sakurai, Toshihiko; Kato, Tomoyuki; Tsuchiya, Norihiko. Fibroblast growth factor receptor type 4 as a potential therapeutic target in clear cell renal cell carcinoma. Bmc Cancer. 2023;23(1):170.  PubMed