Anti FGFR4 pAb (ATL-HPA027273 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA027273-25
  • Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and fGFR4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400735).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor receptor 4
Gene Name: FGFR4
Alternative Gene Name: CD334, JTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005320: 91%, ENSRNOG00000016763: 91%
Entrez Gene ID: 2264
Uniprot ID: P22455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSF
Gene Sequence VEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSF
Gene ID - Mouse ENSMUSG00000005320
Gene ID - Rat ENSRNOG00000016763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FGFR4 pAb (ATL-HPA027273 w/enhanced validation)
Datasheet Anti FGFR4 pAb (ATL-HPA027273 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FGFR4 pAb (ATL-HPA027273 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FGFR4 pAb (ATL-HPA027273 w/enhanced validation)
Datasheet Anti FGFR4 pAb (ATL-HPA027273 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FGFR4 pAb (ATL-HPA027273 w/enhanced validation)