Anti FGFR1OP2 pAb (ATL-HPA038308 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA038308-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FGFR1OP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414429).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FGFR1 oncogene partner 2
Gene Name: FGFR1OP2
Alternative Gene Name: DKFZp564O1863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040242: 100%, ENSRNOG00000001811: 100%
Entrez Gene ID: 26127
Uniprot ID: Q9NVK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDASESTSLSALVTNSD
Gene Sequence NELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDASESTSLSALVTNSD
Gene ID - Mouse ENSMUSG00000040242
Gene ID - Rat ENSRNOG00000001811
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FGFR1OP2 pAb (ATL-HPA038308 w/enhanced validation)
Datasheet Anti FGFR1OP2 pAb (ATL-HPA038308 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FGFR1OP2 pAb (ATL-HPA038308 w/enhanced validation)