Anti FGD5 pAb (ATL-HPA014536)

Atlas Antibodies

Catalog No.:
ATL-HPA014536-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: FYVE, RhoGEF and PH domain containing 5
Gene Name: FGD5
Alternative Gene Name: FLJ00274, FLJ39957, ZFYVE23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034037: 92%, ENSRNOG00000010213: 93%
Entrez Gene ID: 152273
Uniprot ID: Q6ZNL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVD
Gene Sequence NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVD
Gene ID - Mouse ENSMUSG00000034037
Gene ID - Rat ENSRNOG00000010213
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGD5 pAb (ATL-HPA014536)
Datasheet Anti FGD5 pAb (ATL-HPA014536) Datasheet (External Link)
Vendor Page Anti FGD5 pAb (ATL-HPA014536) at Atlas Antibodies

Documents & Links for Anti FGD5 pAb (ATL-HPA014536)
Datasheet Anti FGD5 pAb (ATL-HPA014536) Datasheet (External Link)
Vendor Page Anti FGD5 pAb (ATL-HPA014536)