Anti FGD4 pAb (ATL-HPA039235)

Atlas Antibodies

Catalog No.:
ATL-HPA039235-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FYVE, RhoGEF and PH domain containing 4
Gene Name: FGD4
Alternative Gene Name: CMT4H, frabin, FRABP, ZFYVE6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022788: 53%, ENSRNOG00000059491: 52%
Entrez Gene ID: 121512
Uniprot ID: Q96M96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQ
Gene Sequence EPLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQ
Gene ID - Mouse ENSMUSG00000022788
Gene ID - Rat ENSRNOG00000059491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGD4 pAb (ATL-HPA039235)
Datasheet Anti FGD4 pAb (ATL-HPA039235) Datasheet (External Link)
Vendor Page Anti FGD4 pAb (ATL-HPA039235) at Atlas Antibodies

Documents & Links for Anti FGD4 pAb (ATL-HPA039235)
Datasheet Anti FGD4 pAb (ATL-HPA039235) Datasheet (External Link)
Vendor Page Anti FGD4 pAb (ATL-HPA039235)