Anti FGD1 pAb (ATL-HPA000911)

Atlas Antibodies

Catalog No.: ATL-HPA000911-25

Protein Description: FYVE, RhoGEF and PH domain containing 1
Gene Name: FGD1
Alternative Gene Name: FGDY, ZFYVE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025265: 92%, ENSRNOG00000001254: 31%
Entrez Gene ID: 2245
Uniprot ID: P98174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSDPGASEPGLLARRGSGSALGGPLDPQFVGPSDTSLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPGQSLEPHPEGPQRLRSDP
• Gene Sequence: DSDPGASEPGLLARRGSGSALGGPLDPQFVGPSDTSLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPGQSLEPHPEGPQRLRSDP
• Gene ID - Mouse: ENSMUSG00000025265
• Gene ID - Rat: ENSRNOG00000001254
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FGD1 pAb (ATL-HPA000911) – 1 Found

Thuault, Sylvie; Mamelonet, Claire; Salameh, Joëlle; Ostacolo, Kevin; Chanez, Brice; Salaün, Danièle; Baudelet, Emilie; Audebert, Stéphane; Camoin, Luc; Badache, Ali. A proximity-labeling proteomic approach to investigate invadopodia molecular landscape in breast cancer cells. Scientific Reports. 2020;10(1):6787.