Anti FFAR4 pAb (ATL-HPA042563)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042563-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FFAR4
Alternative Gene Name: GPR120, GPR129, O3FAR1, PGR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054200: 82%, ENSRNOG00000021763: 82%
Entrez Gene ID: 338557
Uniprot ID: Q5NUL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FRVVPQRLPGADQEISICTLIWPTIPGEISWDV |
| Gene Sequence | FRVVPQRLPGADQEISICTLIWPTIPGEISWDV |
| Gene ID - Mouse | ENSMUSG00000054200 |
| Gene ID - Rat | ENSRNOG00000021763 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FFAR4 pAb (ATL-HPA042563) | |
| Datasheet | Anti FFAR4 pAb (ATL-HPA042563) Datasheet (External Link) |
| Vendor Page | Anti FFAR4 pAb (ATL-HPA042563) at Atlas Antibodies |
| Documents & Links for Anti FFAR4 pAb (ATL-HPA042563) | |
| Datasheet | Anti FFAR4 pAb (ATL-HPA042563) Datasheet (External Link) |
| Vendor Page | Anti FFAR4 pAb (ATL-HPA042563) |