Anti FFAR4 pAb (ATL-HPA042563)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042563-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FFAR4
Alternative Gene Name: GPR120, GPR129, O3FAR1, PGR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054200: 82%, ENSRNOG00000021763: 82%
Entrez Gene ID: 338557
Uniprot ID: Q5NUL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRVVPQRLPGADQEISICTLIWPTIPGEISWDV |
Gene Sequence | FRVVPQRLPGADQEISICTLIWPTIPGEISWDV |
Gene ID - Mouse | ENSMUSG00000054200 |
Gene ID - Rat | ENSRNOG00000021763 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FFAR4 pAb (ATL-HPA042563) | |
Datasheet | Anti FFAR4 pAb (ATL-HPA042563) Datasheet (External Link) |
Vendor Page | Anti FFAR4 pAb (ATL-HPA042563) at Atlas Antibodies |
Documents & Links for Anti FFAR4 pAb (ATL-HPA042563) | |
Datasheet | Anti FFAR4 pAb (ATL-HPA042563) Datasheet (External Link) |
Vendor Page | Anti FFAR4 pAb (ATL-HPA042563) |