Anti FFAR4 pAb (ATL-HPA042563)

Atlas Antibodies

SKU: ATL-HPA042563-25

• 

Protein Description: free fatty acid receptor 4
Gene Name: FFAR4
Alternative Gene Name: GPR120, GPR129, O3FAR1, PGR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054200: 82%, ENSRNOG00000021763: 82%
Entrez Gene ID: 338557
Uniprot ID: Q5NUL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRVVPQRLPGADQEISICTLIWPTIPGEISWDV
• Gene Sequence: FRVVPQRLPGADQEISICTLIWPTIPGEISWDV
• Gene ID - Mouse: ENSMUSG00000054200
• Gene ID - Rat: ENSRNOG00000021763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.