Anti FFAR3 pAb (ATL-HPA044681)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044681-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FFAR3
Alternative Gene Name: FFA3R, GPR41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018387: 32%, ENSRNOG00000018377: 33%
Entrez Gene ID: 2865
Uniprot ID: O14843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVAC |
| Gene Sequence | DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVAC |
| Gene ID - Mouse | ENSMUSG00000018387 |
| Gene ID - Rat | ENSRNOG00000018377 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FFAR3 pAb (ATL-HPA044681) | |
| Datasheet | Anti FFAR3 pAb (ATL-HPA044681) Datasheet (External Link) |
| Vendor Page | Anti FFAR3 pAb (ATL-HPA044681) at Atlas Antibodies |
| Documents & Links for Anti FFAR3 pAb (ATL-HPA044681) | |
| Datasheet | Anti FFAR3 pAb (ATL-HPA044681) Datasheet (External Link) |
| Vendor Page | Anti FFAR3 pAb (ATL-HPA044681) |
| Citations for Anti FFAR3 pAb (ATL-HPA044681) – 1 Found |
| Ang, Zhiwei; Er, Jun Zhi; Tan, Nguan Soon; Lu, Jinhua; Liou, Yih-Cherng; Grosse, Johannes; Ding, Jeak Ling. Human and mouse monocytes display distinct signalling and cytokine profiles upon stimulation with FFAR2/FFAR3 short-chain fatty acid receptor agonists. Scientific Reports. 2016;6( 27667443):34145. PubMed |