Anti FEZF1 pAb (ATL-HPA064639)

Atlas Antibodies

Catalog No.: ATL-HPA064639-25

Protein Description: FEZ family zinc finger 1
Gene Name: FEZF1
Alternative Gene Name: ZNF312B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029697: 98%, ENSRNOG00000007608: 95%
Entrez Gene ID: 389549
Uniprot ID: A0PJY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV
• Gene Sequence: YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV
• Gene ID - Mouse: ENSMUSG00000029697
• Gene ID - Rat: ENSRNOG00000007608
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.