Anti FEZF1 pAb (ATL-HPA064639)
Atlas Antibodies
- SKU:
- ATL-HPA064639-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FEZF1
Alternative Gene Name: ZNF312B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029697: 98%, ENSRNOG00000007608: 95%
Entrez Gene ID: 389549
Uniprot ID: A0PJY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV |
Gene Sequence | YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV |
Gene ID - Mouse | ENSMUSG00000029697 |
Gene ID - Rat | ENSRNOG00000007608 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FEZF1 pAb (ATL-HPA064639) | |
Datasheet | Anti FEZF1 pAb (ATL-HPA064639) Datasheet (External Link) |
Vendor Page | Anti FEZF1 pAb (ATL-HPA064639) at Atlas Antibodies |
Documents & Links for Anti FEZF1 pAb (ATL-HPA064639) | |
Datasheet | Anti FEZF1 pAb (ATL-HPA064639) Datasheet (External Link) |
Vendor Page | Anti FEZF1 pAb (ATL-HPA064639) |