Anti FETUB pAb (ATL-HPA035133)

Atlas Antibodies

Catalog No.:
ATL-HPA035133-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fetuin B
Gene Name: FETUB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022871: 54%, ENSRNOG00000001806: 54%
Entrez Gene ID: 26998
Uniprot ID: Q9UGM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQK
Gene Sequence PSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQK
Gene ID - Mouse ENSMUSG00000022871
Gene ID - Rat ENSRNOG00000001806
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FETUB pAb (ATL-HPA035133)
Datasheet Anti FETUB pAb (ATL-HPA035133) Datasheet (External Link)
Vendor Page Anti FETUB pAb (ATL-HPA035133) at Atlas Antibodies

Documents & Links for Anti FETUB pAb (ATL-HPA035133)
Datasheet Anti FETUB pAb (ATL-HPA035133) Datasheet (External Link)
Vendor Page Anti FETUB pAb (ATL-HPA035133)