Anti FES pAb (ATL-HPA001376)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001376-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FES
Alternative Gene Name: FPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053158: 88%, ENSRNOG00000011683: 90%
Entrez Gene ID: 2242
Uniprot ID: P07332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP |
Gene Sequence | DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP |
Gene ID - Mouse | ENSMUSG00000053158 |
Gene ID - Rat | ENSRNOG00000011683 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FES pAb (ATL-HPA001376) | |
Datasheet | Anti FES pAb (ATL-HPA001376) Datasheet (External Link) |
Vendor Page | Anti FES pAb (ATL-HPA001376) at Atlas Antibodies |
Documents & Links for Anti FES pAb (ATL-HPA001376) | |
Datasheet | Anti FES pAb (ATL-HPA001376) Datasheet (External Link) |
Vendor Page | Anti FES pAb (ATL-HPA001376) |
Citations for Anti FES pAb (ATL-HPA001376) – 1 Found |
Olvedy, Michael; Tisserand, Julie C; Luciani, Flavie; Boeckx, Bram; Wouters, Jasper; Lopez, Sophie; Rambow, Florian; Aibar, Sara; Thienpont, Bernard; Barra, Jasmine; Köhler, Corinna; Radaelli, Enrico; Tartare-Deckert, Sophie; Aerts, Stein; Dubreuil, Patrice; van den Oord, Joost J; Lambrechts, Diether; De Sepulveda, Paulo; Marine, Jean-Christophe. Comparative oncogenomics identifies tyrosine kinase FES as a tumor suppressor in melanoma. The Journal Of Clinical Investigation. 2017;127(6):2310-2325. PubMed |