Anti FES pAb (ATL-HPA001376)

Atlas Antibodies

Catalog No.: ATL-HPA001376-25

Protein Description: FES proto-oncogene, tyrosine kinase
Gene Name: FES
Alternative Gene Name: FPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053158: 88%, ENSRNOG00000011683: 90%
Entrez Gene ID: 2242
Uniprot ID: P07332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
• Gene Sequence: DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
• Gene ID - Mouse: ENSMUSG00000053158
• Gene ID - Rat: ENSRNOG00000011683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FES pAb (ATL-HPA001376) – 1 Found

Olvedy, Michael; Tisserand, Julie C; Luciani, Flavie; Boeckx, Bram; Wouters, Jasper; Lopez, Sophie; Rambow, Florian; Aibar, Sara; Thienpont, Bernard; Barra, Jasmine; Köhler, Corinna; Radaelli, Enrico; Tartare-Deckert, Sophie; Aerts, Stein; Dubreuil, Patrice; van den Oord, Joost J; Lambrechts, Diether; De Sepulveda, Paulo; Marine, Jean-Christophe. Comparative oncogenomics identifies tyrosine kinase FES as a tumor suppressor in melanoma. The Journal Of Clinical Investigation. 2017;127(6):2310-2325.