Anti FES pAb (ATL-HPA001376)

Atlas Antibodies

Catalog No.:
ATL-HPA001376-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: FES proto-oncogene, tyrosine kinase
Gene Name: FES
Alternative Gene Name: FPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053158: 88%, ENSRNOG00000011683: 90%
Entrez Gene ID: 2242
Uniprot ID: P07332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
Gene Sequence DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
Gene ID - Mouse ENSMUSG00000053158
Gene ID - Rat ENSRNOG00000011683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FES pAb (ATL-HPA001376)
Datasheet Anti FES pAb (ATL-HPA001376) Datasheet (External Link)
Vendor Page Anti FES pAb (ATL-HPA001376) at Atlas Antibodies

Documents & Links for Anti FES pAb (ATL-HPA001376)
Datasheet Anti FES pAb (ATL-HPA001376) Datasheet (External Link)
Vendor Page Anti FES pAb (ATL-HPA001376)
Citations for Anti FES pAb (ATL-HPA001376) – 1 Found
Olvedy, Michael; Tisserand, Julie C; Luciani, Flavie; Boeckx, Bram; Wouters, Jasper; Lopez, Sophie; Rambow, Florian; Aibar, Sara; Thienpont, Bernard; Barra, Jasmine; Köhler, Corinna; Radaelli, Enrico; Tartare-Deckert, Sophie; Aerts, Stein; Dubreuil, Patrice; van den Oord, Joost J; Lambrechts, Diether; De Sepulveda, Paulo; Marine, Jean-Christophe. Comparative oncogenomics identifies tyrosine kinase FES as a tumor suppressor in melanoma. The Journal Of Clinical Investigation. 2017;127(6):2310-2325.  PubMed