Anti FERMT1 pAb (ATL-HPA041966)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041966-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FERMT1
Alternative Gene Name: C20orf42, FLJ20116, KIND1, UNC112A, URP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027356: 86%, ENSRNOG00000021274: 84%
Entrez Gene ID: 55612
Uniprot ID: Q9BQL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL |
| Gene Sequence | ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL |
| Gene ID - Mouse | ENSMUSG00000027356 |
| Gene ID - Rat | ENSRNOG00000021274 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FERMT1 pAb (ATL-HPA041966) | |
| Datasheet | Anti FERMT1 pAb (ATL-HPA041966) Datasheet (External Link) |
| Vendor Page | Anti FERMT1 pAb (ATL-HPA041966) at Atlas Antibodies |
| Documents & Links for Anti FERMT1 pAb (ATL-HPA041966) | |
| Datasheet | Anti FERMT1 pAb (ATL-HPA041966) Datasheet (External Link) |
| Vendor Page | Anti FERMT1 pAb (ATL-HPA041966) |