Anti FERMT1 pAb (ATL-HPA041966)

Atlas Antibodies

Catalog No.:
ATL-HPA041966-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fermitin family member 1
Gene Name: FERMT1
Alternative Gene Name: C20orf42, FLJ20116, KIND1, UNC112A, URP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027356: 86%, ENSRNOG00000021274: 84%
Entrez Gene ID: 55612
Uniprot ID: Q9BQL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL
Gene Sequence ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL
Gene ID - Mouse ENSMUSG00000027356
Gene ID - Rat ENSRNOG00000021274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FERMT1 pAb (ATL-HPA041966)
Datasheet Anti FERMT1 pAb (ATL-HPA041966) Datasheet (External Link)
Vendor Page Anti FERMT1 pAb (ATL-HPA041966) at Atlas Antibodies

Documents & Links for Anti FERMT1 pAb (ATL-HPA041966)
Datasheet Anti FERMT1 pAb (ATL-HPA041966) Datasheet (External Link)
Vendor Page Anti FERMT1 pAb (ATL-HPA041966)