Anti FERMT1 pAb (ATL-HPA039778)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039778-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FERMT1
Alternative Gene Name: C20orf42, FLJ20116, KIND1, UNC112A, URP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027356: 85%, ENSRNOG00000021274: 85%
Entrez Gene ID: 55612
Uniprot ID: Q9BQL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLA |
Gene Sequence | DSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLA |
Gene ID - Mouse | ENSMUSG00000027356 |
Gene ID - Rat | ENSRNOG00000021274 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FERMT1 pAb (ATL-HPA039778) | |
Datasheet | Anti FERMT1 pAb (ATL-HPA039778) Datasheet (External Link) |
Vendor Page | Anti FERMT1 pAb (ATL-HPA039778) at Atlas Antibodies |
Documents & Links for Anti FERMT1 pAb (ATL-HPA039778) | |
Datasheet | Anti FERMT1 pAb (ATL-HPA039778) Datasheet (External Link) |
Vendor Page | Anti FERMT1 pAb (ATL-HPA039778) |