Anti FERMT1 pAb (ATL-HPA039778)

Atlas Antibodies

SKU: ATL-HPA039778-25

• 

Protein Description: fermitin family member 1
Gene Name: FERMT1
Alternative Gene Name: C20orf42, FLJ20116, KIND1, UNC112A, URP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027356: 85%, ENSRNOG00000021274: 85%
Entrez Gene ID: 55612
Uniprot ID: Q9BQL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLA
• Gene Sequence: DSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLA
• Gene ID - Mouse: ENSMUSG00000027356
• Gene ID - Rat: ENSRNOG00000021274
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.