Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043494-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FERD3L
Alternative Gene Name: bHLHa31, N-TWIST, NATO3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046518: 59%, ENSRNOG00000011091: 56%
Entrez Gene ID: 222894
Uniprot ID: Q96RJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQ |
Gene Sequence | MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQ |
Gene ID - Mouse | ENSMUSG00000046518 |
Gene ID - Rat | ENSRNOG00000011091 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) | |
Datasheet | Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) | |
Datasheet | Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) |