Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043494-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Fer3-like bHLH transcription factor
Gene Name: FERD3L
Alternative Gene Name: bHLHa31, N-TWIST, NATO3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046518: 59%, ENSRNOG00000011091: 56%
Entrez Gene ID: 222894
Uniprot ID: Q96RJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQ
Gene Sequence MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQ
Gene ID - Mouse ENSMUSG00000046518
Gene ID - Rat ENSRNOG00000011091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation)
Datasheet Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation)
Datasheet Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FERD3L pAb (ATL-HPA043494 w/enhanced validation)