Anti FER pAb (ATL-HPA007641)

Atlas Antibodies

Catalog No.:
ATL-HPA007641-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fer (fps/fes related) tyrosine kinase
Gene Name: FER
Alternative Gene Name: PPP1R74, TYK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000127: 93%, ENSRNOG00000015898: 94%
Entrez Gene ID: 2241
Uniprot ID: P16591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKS
Gene Sequence QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKS
Gene ID - Mouse ENSMUSG00000000127
Gene ID - Rat ENSRNOG00000015898
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FER pAb (ATL-HPA007641)
Datasheet Anti FER pAb (ATL-HPA007641) Datasheet (External Link)
Vendor Page Anti FER pAb (ATL-HPA007641) at Atlas Antibodies

Documents & Links for Anti FER pAb (ATL-HPA007641)
Datasheet Anti FER pAb (ATL-HPA007641) Datasheet (External Link)
Vendor Page Anti FER pAb (ATL-HPA007641)
Citations for Anti FER pAb (ATL-HPA007641) – 2 Found
Mitsunari, Kensuke; Miyata, Yasuyoshi; Watanabe, Shin-Ichi; Asai, Akihiro; Yasuda, Takuji; Kanda, Shigeru; Sakai, Hideki. Stromal expression of Fer suppresses tumor progression in renal cell carcinoma and is a predictor of survival. Oncology Letters. 2017;13(2):834-840.  PubMed
Elkis, Yoav; Cohen, Moshe; Yaffe, Etai; Satmary-Tusk, Shirly; Feldman, Tal; Hikri, Elad; Nyska, Abraham; Feiglin, Ariel; Ofran, Yanay; Shpungin, Sally; Nir, Uri. A novel Fer/FerT targeting compound selectively evokes metabolic stress and necrotic death in malignant cells. Nature Communications. 2017;8(1):940.  PubMed