Anti FER pAb (ATL-HPA007641)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007641-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FER
Alternative Gene Name: PPP1R74, TYK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000127: 93%, ENSRNOG00000015898: 94%
Entrez Gene ID: 2241
Uniprot ID: P16591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKS |
Gene Sequence | QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKS |
Gene ID - Mouse | ENSMUSG00000000127 |
Gene ID - Rat | ENSRNOG00000015898 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FER pAb (ATL-HPA007641) | |
Datasheet | Anti FER pAb (ATL-HPA007641) Datasheet (External Link) |
Vendor Page | Anti FER pAb (ATL-HPA007641) at Atlas Antibodies |
Documents & Links for Anti FER pAb (ATL-HPA007641) | |
Datasheet | Anti FER pAb (ATL-HPA007641) Datasheet (External Link) |
Vendor Page | Anti FER pAb (ATL-HPA007641) |
Citations for Anti FER pAb (ATL-HPA007641) – 2 Found |
Mitsunari, Kensuke; Miyata, Yasuyoshi; Watanabe, Shin-Ichi; Asai, Akihiro; Yasuda, Takuji; Kanda, Shigeru; Sakai, Hideki. Stromal expression of Fer suppresses tumor progression in renal cell carcinoma and is a predictor of survival. Oncology Letters. 2017;13(2):834-840. PubMed |
Elkis, Yoav; Cohen, Moshe; Yaffe, Etai; Satmary-Tusk, Shirly; Feldman, Tal; Hikri, Elad; Nyska, Abraham; Feiglin, Ariel; Ofran, Yanay; Shpungin, Sally; Nir, Uri. A novel Fer/FerT targeting compound selectively evokes metabolic stress and necrotic death in malignant cells. Nature Communications. 2017;8(1):940. PubMed |