Anti FDXACB1 pAb (ATL-HPA039012)

Atlas Antibodies

Catalog No.: ATL-HPA039012-25

Protein Description: ferredoxin-fold anticodon binding domain containing 1
Gene Name: FDXACB1
Alternative Gene Name: hCG_2033039, LOC91893
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037845: 59%, ENSRNOG00000010743: 57%
Entrez Gene ID: 91893
Uniprot ID: Q9BRP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HPIKTINEKLIAELGKVFPLKRLKCSYPLLPQEGTSVLPFWNCDFLSAAFWISLHEDNSNSESLTGGTSQDVEDFLVSFSELSLLKNPGRDGKEEACEGTCG
• Gene Sequence: HPIKTINEKLIAELGKVFPLKRLKCSYPLLPQEGTSVLPFWNCDFLSAAFWISLHEDNSNSESLTGGTSQDVEDFLVSFSELSLLKNPGRDGKEEACEGTCG
• Gene ID - Mouse: ENSMUSG00000037845
• Gene ID - Rat: ENSRNOG00000010743
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.