Anti FDFT1 pAb (ATL-HPA008874)

Atlas Antibodies

Catalog No.:
ATL-HPA008874-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: farnesyl-diphosphate farnesyltransferase 1
Gene Name: FDFT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021273: 85%, ENSRNOG00000021314: 81%
Entrez Gene ID: 2222
Uniprot ID: P37268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Gene Sequence PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Gene ID - Mouse ENSMUSG00000021273
Gene ID - Rat ENSRNOG00000021314
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FDFT1 pAb (ATL-HPA008874)
Datasheet Anti FDFT1 pAb (ATL-HPA008874) Datasheet (External Link)
Vendor Page Anti FDFT1 pAb (ATL-HPA008874) at Atlas Antibodies

Documents & Links for Anti FDFT1 pAb (ATL-HPA008874)
Datasheet Anti FDFT1 pAb (ATL-HPA008874) Datasheet (External Link)
Vendor Page Anti FDFT1 pAb (ATL-HPA008874)
Citations for Anti FDFT1 pAb (ATL-HPA008874) – 1 Found
Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17.  PubMed