Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001295-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: FCN1
Alternative Gene Name: FCNM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026835: 72%, ENSRNOG00000009342: 71%
Entrez Gene ID: 2219
Uniprot ID: O00602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWS |
| Gene Sequence | QGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWS |
| Gene ID - Mouse | ENSMUSG00000026835 |
| Gene ID - Rat | ENSRNOG00000009342 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation) | |
| Datasheet | Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation) | |
| Datasheet | Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation) |
| Citations for Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation) – 2 Found |
| Sterba, Jan; Dupejova, Jarmila; Fiser, Miroslav; Vancova, Marie; Grubhoffer, Libor. Fibrinogen-related proteins in ixodid ticks. Parasites & Vectors. 2011;4( 21729260):127. PubMed |
| Katayama, Michihito; Ota, Kaori; Nagi-Miura, Noriko; Ohno, Naohito; Yabuta, Norikazu; Nojima, Hiroshi; Kumanogoh, Atsushi; Hirano, Toru. Ficolin-1 is a promising therapeutic target for autoimmune diseases. International Immunology. 2019;31(1):23-32. PubMed |