Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001295-100

• 
• 

Protein Description: ficolin (collagen/fibrinogen domain containing) 1
Gene Name: FCN1
Alternative Gene Name: FCNM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026835: 72%, ENSRNOG00000009342: 71%
Entrez Gene ID: 2219
Uniprot ID: O00602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWS
• Gene Sequence: QGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWS
• Gene ID - Mouse: ENSMUSG00000026835
• Gene ID - Rat: ENSRNOG00000009342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FCN1 pAb (ATL-HPA001295 w/enhanced validation) – 2 Found

Sterba, Jan; Dupejova, Jarmila; Fiser, Miroslav; Vancova, Marie; Grubhoffer, Libor. Fibrinogen-related proteins in ixodid ticks. Parasites & Vectors. 2011;4( 21729260):127. 

Katayama, Michihito; Ota, Kaori; Nagi-Miura, Noriko; Ohno, Naohito; Yabuta, Norikazu; Nojima, Hiroshi; Kumanogoh, Atsushi; Hirano, Toru. Ficolin-1 is a promising therapeutic target for autoimmune diseases. International Immunology. 2019;31(1):23-32.