Anti FCN1 pAb (ATL-HPA000685 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA000685-25

• 
• 

Protein Description: ficolin (collagen/fibrinogen domain containing) 1
Gene Name: FCN1
Alternative Gene Name: FCNM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026835: 65%, ENSRNOG00000009342: 75%
Entrez Gene ID: 2219
Uniprot ID: O00602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
• Gene Sequence: LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
• Gene ID - Mouse: ENSMUSG00000026835
• Gene ID - Rat: ENSRNOG00000009342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FCN1 pAb (ATL-HPA000685 w/enhanced validation) – 2 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. 

Okuzaki, Daisuke; Kimura, Shoichi; Yabuta, Norikazu; Ohmine, Toshinari; Nojima, Hiroshi. LeukoCatch, a quick and efficient tool for the preparation of leukocyte extracts from blood. Bmc Clinical Pathology. 2011;11( 21849019):9.