Anti FCHSD2 pAb (ATL-HPA038545)

Atlas Antibodies

Catalog No.: ATL-HPA038545-25

Protein Description: FCH and double SH3 domains 2
Gene Name: FCHSD2
Alternative Gene Name: KIAA0769, SH3MD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030691: 92%, ENSRNOG00000019319: 89%
Entrez Gene ID: 9873
Uniprot ID: O94868
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEELSASENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQASRHTPETSYGKLRPVRA
• Gene Sequence: VEELSASENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQASRHTPETSYGKLRPVRA
• Gene ID - Mouse: ENSMUSG00000030691
• Gene ID - Rat: ENSRNOG00000019319
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.