Anti FCHSD2 pAb (ATL-HPA038545)

Atlas Antibodies

SKU:
ATL-HPA038545-25
  • Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuronal processes.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FCH and double SH3 domains 2
Gene Name: FCHSD2
Alternative Gene Name: KIAA0769, SH3MD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030691: 92%, ENSRNOG00000019319: 89%
Entrez Gene ID: 9873
Uniprot ID: O94868
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEELSASENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQASRHTPETSYGKLRPVRA
Gene Sequence VEELSASENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQASRHTPETSYGKLRPVRA
Gene ID - Mouse ENSMUSG00000030691
Gene ID - Rat ENSRNOG00000019319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FCHSD2 pAb (ATL-HPA038545)
Datasheet Anti FCHSD2 pAb (ATL-HPA038545) Datasheet (External Link)
Vendor Page Anti FCHSD2 pAb (ATL-HPA038545) at Atlas Antibodies

Documents & Links for Anti FCHSD2 pAb (ATL-HPA038545)
Datasheet Anti FCHSD2 pAb (ATL-HPA038545) Datasheet (External Link)
Vendor Page Anti FCHSD2 pAb (ATL-HPA038545)